# sermorelin — GHRH(1-29) Evidence-Intelligence Dashboard

> sermorelin is a 29-amino acid fragment of endogenous GHRH studied in human clinical trials since 1990. Mechanism, pharmacokinetics, efficacy data, and regulatory status indexed on one analytic surface.

## Compound overview

sermorelin is the biologically active N-terminal 29-amino acid fragment of endogenous human GHRH. Molecular weight: 3358 Da. Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, C-terminally amidated. CAS 86168-78-7.

Sermorelin binds the GHRH receptor (GHRHR) on anterior pituitary somatotrophs, activating the Gs/adenylyl cyclase/cAMP/PKA cascade and triggering voltage-gated calcium influx. The result is pulsatile GH synthesis and secretion [1]. Downstream, elevated GH stimulates hepatic IGF-1 synthesis, which mediates effects on protein synthesis, lipolysis, and bone remodeling [1].

The somatostatin feedback loop — an inhibitory peptide secreted by the hypothalamus — caps peak GH output. That mechanism is the primary proposed safety differentiator between sermorelin and exogenous GH: pulsatile, feedback-gated release versus sustained supraphysiological levels [2].

FDA approval for Geref (sermorelin acetate) came in 1990 (diagnostic) and 1997 (therapeutic, pediatric GHD). EMD Serono withdrew both formulations in 2008-2009 for commercial reasons. The FDA Federal Register explicitly documented that withdrawal was not for reasons of safety or effectiveness [12]. No FDA-approved sermorelin product exists in the US market as of 2026.

## Sermorelin Benefits: What the Research Shows

Research attributes sermorelin's effects to the GH/IGF-1 axis it activates. The documented outcomes across clinical studies span four categories.

**Body composition.** GH secretagogue class studies found 1.1-1.6 kg fat-free mass increases and approximately 1.5-fold IGF-1 elevation over two-year periods in healthy older adults [11][16]. GHRH analog class data from tesamorelin RCTs show mean visceral adipose tissue reduction of 27.71 cm2 [13]. Lean mass improvement is the most consistently demonstrated body composition outcome; functional performance improvements (stair-climb power, tandem walking) have also been documented in randomized trials [16].

**GH/IGF-1 restoration.** In hypogonadal adult men, growth hormone secretagogue treatment raised serum IGF-1 from a mean of 159.5 ng/mL to 239.0 ng/mL (p<0.0001) over an average 134-day period at 100 mcg three times daily [3]. In prepubertal children with GHD, 30 mcg/kg once daily at bedtime doubled height velocity from 4.1 to 8.0 cm/year over the first six months [1].

**Sleep architecture.** GHRH administration during the first half of the night increased both GH plasma levels and slow-wave sleep (SWS) duration in controlled human studies, while morning administration raised GH without altering sleep architecture [7]. The nocturnal coupling is the rationale for pre-sleep dosing used across clinical protocols.

**Bone density.** Multi-year GH secretagogue trials in older adults documented improvements in bone mineral density alongside lean mass gains [14]. Effects were secondary to GH/IGF-1 axis restoration rather than a direct bone-active mechanism.

## Sermorelin as a GHRH-Analog Peptide

Sermorelin is a synthetic peptide — specifically a GHRH-analog peptide — distinguished from ghrelin-receptor agonists (ipamorelin, GHRP-2, GHRP-6) by its molecular target. GHRH-receptor agonism increases the number of somatotrophs releasing GH per pulse. GHS-R1a agonism (the ghrelin pathway) increases GH release per individual somatotroph and suppresses somatostatin [18]. The two mechanisms are complementary and have been combined in compound pharmacy protocols to produce synergistic GH pulse amplitude [18].

Sermorelin vs CJC-1295: sermorelin is the unmodified GHRH(1-29) sequence with an approximately 11-12 minute plasma half-life. CJC-1295 incorporates amino acid substitutions that resist DPP-4 enzymatic degradation, extending active half-life to 30 minutes (without DAC) or 6-8 days (with DAC via albumin binding) [19]. The longer half-life of CJC-1295 with DAC produces a sustained GH/IGF-1 bleed rather than the physiological pulsatile pattern that sermorelin preserves.

Among GHRH-class peptides, sermorelin has the longest human safety and regulatory record, including the 1990 and 1997 FDA approvals and a 350-patient clinical trial adverse-event pool [2][15].

## What Does Sermorelin Do to the Body?

Sermorelin stimulates pituitary somatotroph cells to synthesize and release GH in pulsatile bursts [1]. The sequence: GHRHR binding activates the Gs protein, adenylyl cyclase elevates cAMP, PKA phosphorylates secretory machinery, and voltage-gated calcium channels open, triggering GH secretory granule exocytosis [1].

Elevated GH then signals hepatic IGF-1 synthesis via the GH receptor. IGF-1 binds IGF-1R on peripheral tissues and mediates the downstream anabolic cascade — protein synthesis in skeletal muscle, lipolysis in adipose tissue (especially visceral fat depots), and bone remodeling [14].

Pulsatile GH amplitude — not tonic GH level or pulse frequency — is the primary determinant of fasting lipolysis. In a controlled study of 15 healthy subjects, GH pulse area under the curve correlated strongly with lipolysis rate (R=0.49, p=0.0015) [9]. Sermorelin's short half-life (~11-12 minutes) means the peptide clears before the GH pulse it triggers peaks; that 2-4 hour GH elevation preserves the pulsatile physiology that direct GH injections suppress [4][12].

As GH levels rise, somatostatin feedback from the hypothalamus is upregulated. This caps peak GH output and is the mechanism that prevents GH overstimulation with GHRH-analog dosing [2].

## Sermorelin in Male Subjects: Clinical Observations

The most rigorous adult male efficacy data comes from a study of 14 hypogonadal men treated with GH secretagogues at 100 mcg three times daily. IGF-1 rose from a mean of 159.5 ng/mL to 239.0 ng/mL (delta: +79.5 ng/mL, p<0.0001) over a mean 134-day period [3]. Men concurrently taking estrogen-blocking agents showed smaller IGF-1 increases, indicating that estrogen facilitates GH axis responsiveness [3].

GH/IGF-1 axis decline correlates with age-related sarcopenia: advanced aging impairs signaling through the IGF-1 receptor due to reduced receptor density and affinity [14]. GH/IGF-1 elevation via secretagogues is necessary but not sufficient for functional muscle gain; the literature consistently shows that resistance exercise and caloric adequacy are required alongside the hormonal stimulus [14].

Effects on testosterone across sermorelin trials were secondary and inconsistent. Sermorelin acts on the GH axis, not the HPG (hypothalamic-pituitary-gonadal) axis directly.

## References

[1] Thorner M, Rochiccioli P, Colle M, Lanes R, Grunt J, Galazka A, Landy H, Eengrand P, Shah S. Once daily subcutaneous growth hormone-releasing hormone therapy accelerates growth in growth hormone-deficient children during the first year of therapy. Journal of Clinical Endocrinology and Metabolism. 1996;81(3). DOI: 10.1210/jcem.81.3.8772599. PMID: 8772599. https://pubmed.ncbi.nlm.nih.gov/8772599/
[2] Prakash A, Goa KL. Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic growth hormone deficiency. BioDrugs. 1999;12(2). DOI: 10.2165/00063030-199912020-00007. PMID: 18031173. https://pubmed.ncbi.nlm.nih.gov/18031173/
[3] Sigalos JT, Pastuszak AW, Allison A, Ohlander SJ, Herati A, Lindgren MC, Lipshultz LI. Growth Hormone Secretagogue Treatment in Hypogonadal Men Raises Serum Insulin-Like Growth Factor-1 Levels. American Journal of Men's Health. 2017. DOI: 10.1177/1557988317718662. PMID: 28830317. https://pubmed.ncbi.nlm.nih.gov/28830317/
[4] EMD Serono. Sermorelin Acetate (Geref) Prescribing Information. FDA-approved prescribing information. 2008. https://www.rxlist.com/sermorelin-acetate-drug.htm
[7] Schier T, Guldner J, Colla M, Holsboer F, Steiger A. Changes in sleep-endocrine activity after growth hormone-releasing hormone depend on time of administration. Journal of Neuroendocrinology. 1997;9(6). DOI: 10.1046/j.1365-2826.1997.00565.x. PMID: 9089471. https://pubmed.ncbi.nlm.nih.gov/9089471/
[9] Goldenberg N, Horowitz JF, Gorgey A, Sakharova A, Barkan AL. Role of pulsatile growth hormone (GH) secretion in the regulation of lipolysis in fasting humans. Clinical Diabetes and Endocrinology. 2022. DOI: 10.1186/s40842-022-00137-y. PMID: 35101148. https://pmc.ncbi.nlm.nih.gov/articles/PMC8805297/
[11] Smith RG, Thorner MO. Growth Hormone Secretagogues as Potential Therapeutic Agents to Restore Growth Hormone Secretion in Older Subjects to Those Observed in Young Adults. Journals of Gerontology Series A: Biological Sciences and Medical Sciences. 2023. DOI: 10.1093/gerona/glad022. PMID: 37325967. https://pmc.ncbi.nlm.nih.gov/articles/PMC10272984/
[12] Fernandez-Garza LE, Guillen-Silva F, Sotelo-Ibarra MA, Dominguez-Mendoza AE, Barrera-Barrera SA, Barrera-Saldana HA. Growth hormone and aging: a clinical review. Frontiers in Aging. 2025. DOI: 10.3389/fragi.2025.1549453. https://www.frontiersin.org/journals/aging/articles/10.3389/fragi.2025.1549453
[13] Multiple authors (meta-analysis). Body composition, hepatic fat, metabolic, and safety outcomes of Tesamorelin, a GHRH analogue, in HIV-associated lipodystrophy: A meta-analysis of randomized controlled trials. Obesity Reviews. 2025. DOI: PMID 41545261 PMID: 41545261. https://pubmed.ncbi.nlm.nih.gov/41545261/
[14] Giovannini S, Marzetti E, Borst SE, Leeuwenburgh C. Modulation of GH/IGF-1 axis: Potential strategies to counteract sarcopenia in older adults. Mechanisms of Ageing and Development. 2008. DOI: 10.1016/j.mad.2008.08.001. PMID: 18762207. https://pmc.ncbi.nlm.nih.gov/articles/PMC5992490/
[15] EMD Serono. Sermorelin Acetate (Geref) Prescribing Information — Clinical Trials Adverse Events. FDA-approved prescribing information. 2008. https://www.rxlist.com/sermorelin-acetate-drug.htm
[16] Smith RG, Thorner MO. Growth Hormone Secretagogues as Potential Therapeutic Agents to Restore Growth Hormone Secretion in Older Subjects to Those Observed in Young Adults (capromorelin multicenter data). Journals of Gerontology Series A. 2023. DOI: 10.1093/gerona/glad022. PMID: 37325967. https://pmc.ncbi.nlm.nih.gov/articles/PMC10272984/
[18] Sinha DK et al. Beyond the androgen receptor: the role of growth hormone secretagogues in the modern management of body composition in hypogonadal males. Translational Andrology and Urology. 2020. https://tau.amegroups.org/article/view/33160/28655
[19] Wikipedia contributors. Sermorelin — structural and pharmacokinetic data. Wikipedia. 2024. https://en.wikipedia.org/wiki/Sermorelin

---

Evidence-intelligence dashboard for the GHRH(1-29) literature — twenty findings indexed, confidence-rated, and not for sale.