sermorelin is a GHRH(1-29) analog studied across four decades of pulse-physiology and clinical research

sermorelin is the biologically active N-terminal 29-amino acid fragment of endogenous human GHRH. Molecular weight: 3358 Da. Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, C-terminally amidated. CAS 86168-78-7.

Sermorelin binds the GHRH receptor (GHRHR) on anterior pituitary somatotrophs, activating the Gs/adenylyl cyclase/cAMP/PKA cascade and triggering voltage-gated calcium influx. The result is pulsatile GH synthesis and secretion.[1] Downstream, elevated GH stimulates hepatic IGF-1 synthesis, which mediates effects on protein synthesis, lipolysis, and bone remodeling.[1]

The somatostatin feedback loop — an inhibitory peptide secreted by the hypothalamus — caps peak GH output. That mechanism is the primary proposed safety differentiator between sermorelin and exogenous GH: pulsatile, feedback-gated release versus sustained supraphysiological levels.[2]

FDA approval for Geref (sermorelin acetate) came in 1990 (diagnostic) and 1997 (therapeutic, pediatric GHD). EMD Serono withdrew both formulations in 2008–2009 for commercial reasons. The FDA Federal Register explicitly documented that withdrawal was not for reasons of safety or effectiveness.[12] No FDA-approved sermorelin product exists in the US market as of 2026.

Research attributes sermorelin's effects to the GH/IGF-1 axis it activates. The documented outcomes across clinical studies span four categories.

Body composition. GH secretagogue class studies found 1.1–1.6 kg fat-free mass increases and approximately 1.5-fold IGF-1 elevation over two-year periods in healthy older adults.[11][16] GHRH analog class data from tesamorelin RCTs show mean visceral adipose tissue reduction of 27.71 cm².[13]

GH/IGF-1 restoration. In hypogonadal adult men, growth hormone secretagogue treatment raised serum IGF-1 from a mean of 159.5 ng/mL to 239.0 ng/mL (p<0.0001) over an average 134-day period at 100 mcg three times daily.[3] In prepubertal children with GHD, 30 mcg/kg once daily at bedtime doubled height velocity from 4.1 to 8.0 cm/year over the first six months.[1]

Sleep architecture. GHRH administration during the first half of the night increased both GH plasma levels and slow-wave sleep (SWS) duration in controlled human studies, while morning administration raised GH without altering sleep architecture.[7]

Bone density. Multi-year GH secretagogue trials in older adults documented improvements in bone mineral density alongside lean mass gains.[14]

Sermorelin is a synthetic peptide — specifically a GHRH-analog peptide — distinguished from ghrelin-receptor agonists (ipamorelin, GHRP-2, GHRP-6) by its molecular target. GHRH-receptor agonism increases the number of somatotrophs releasing GH per pulse. GHS-R1a agonism (the ghrelin pathway) increases GH release per individual somatotroph and suppresses somatostatin.[18]

Sermorelin vs CJC-1295: sermorelin is the unmodified GHRH(1-29) sequence with an approximately 11–12 minute plasma half-life. CJC-1295 incorporates amino acid substitutions that resist DPP-4 enzymatic degradation, extending active half-life to 30 minutes (without DAC) or 6–8 days (with DAC via albumin binding).[19] The longer half-life of CJC-1295 with DAC produces a sustained GH/IGF-1 bleed rather than the physiological pulsatile pattern that sermorelin preserves.

Among GHRH-class peptides, sermorelin has the longest human safety and regulatory record, including the 1990 and 1997 FDA approvals and a 350-patient clinical trial adverse-event pool.[2][15]

Sermorelin stimulates pituitary somatotroph cells to synthesize and release GH in pulsatile bursts.[1] The sequence: GHRHR binding activates the Gs protein, adenylyl cyclase elevates cAMP, PKA phosphorylates secretory machinery, and voltage-gated calcium channels open, triggering GH secretory granule exocytosis.[1]

Elevated GH then signals hepatic IGF-1 synthesis via the GH receptor. IGF-1 binds IGF-1R on peripheral tissues and mediates the downstream anabolic cascade — protein synthesis in skeletal muscle, lipolysis in adipose tissue (especially visceral fat depots), and bone remodeling.[14]

Pulsatile GH amplitude — not tonic GH level or pulse frequency — is the primary determinant of fasting lipolysis. In a controlled study of 15 healthy subjects, GH pulse area under the curve correlated strongly with lipolysis rate (R=0.49, p=0.0015).[9] Sermorelin's short half-life (~11–12 minutes) means the peptide clears before the GH pulse it triggers peaks; that 2–4 hour GH elevation preserves the pulsatile physiology that direct GH injections suppress.[4][12]

The most rigorous adult male efficacy data comes from a study of 14 hypogonadal men treated with GH secretagogues at 100 mcg three times daily. IGF-1 rose from a mean of 159.5 ng/mL to 239.0 ng/mL (delta: +79.5 ng/mL, p<0.0001) over a mean 134-day period.[3]

GH/IGF-1 axis decline correlates with age-related sarcopenia: advanced aging impairs signaling through the IGF-1 receptor due to reduced receptor density and affinity.[14] GH/IGF-1 elevation via secretagogues is necessary but not sufficient for functional muscle gain; the literature consistently shows that resistance exercise and caloric adequacy are required alongside the hormonal stimulus.[14]

Effects on testosterone across sermorelin trials were secondary and inconsistent. Sermorelin acts on the GH axis, not the HPG (hypothalamic-pituitary-gonadal) axis directly.