sermorelin is a GHRH(1-29) analog studied across four decades of pulse-physiology and clinical research
Twenty primary findings indexed, confidence-rated, and cross-referenced. Mechanism through regulatory status. Every quantitative claim sourced.
Compound overview
sermorelin is the biologically active N-terminal 29-amino acid fragment of endogenous human GHRH. Molecular weight: 3358 Da. Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, C-terminally amidated. CAS 86168-78-7.
Sermorelin binds the GHRH receptor (GHRHR) on anterior pituitary somatotrophs, activating the Gs/adenylyl cyclase/cAMP/PKA cascade and triggering voltage-gated calcium influx. The result is pulsatile GH synthesis and secretion [1]. Downstream, elevated GH stimulates hepatic IGF-1 synthesis, which mediates effects on protein synthesis, lipolysis, and bone remodeling [1].
The somatostatin feedback loop — an inhibitory peptide secreted by the hypothalamus — caps peak GH output. That mechanism is the primary proposed safety differentiator between sermorelin and exogenous GH: pulsatile, feedback-gated release versus sustained supraphysiological levels [2].
FDA approval for Geref (sermorelin acetate) came in 1990 (diagnostic) and 1997 (therapeutic, pediatric GHD). EMD Serono withdrew both formulations in 2008-2009 for commercial reasons. The FDA Federal Register explicitly documented that withdrawal was not for reasons of safety or effectiveness [12]. No FDA-approved sermorelin product exists in the US market as of 2026.
Sermorelin Benefits: What the Research Shows
Research attributes sermorelin's effects to the GH/IGF-1 axis it activates. The documented outcomes across clinical studies span four categories.
Body composition. GH secretagogue class studies found 1.1-1.6 kg fat-free mass increases and approximately 1.5-fold IGF-1 elevation over two-year periods in healthy older adults [11][16]. GHRH analog class data from tesamorelin RCTs show mean visceral adipose tissue reduction of 27.71 cm2 [13]. Lean mass improvement is the most consistently demonstrated body composition outcome; functional performance improvements (stair-climb power, tandem walking) have also been documented in randomized trials [16].
GH/IGF-1 restoration. In hypogonadal adult men, growth hormone secretagogue treatment raised serum IGF-1 from a mean of 159.5 ng/mL to 239.0 ng/mL (p<0.0001) over an average 134-day period at 100 mcg three times daily [3]. In prepubertal children with GHD, 30 mcg/kg once daily at bedtime doubled height velocity from 4.1 to 8.0 cm/year over the first six months [1].
Sleep architecture. GHRH administration during the first half of the night increased both GH plasma levels and slow-wave sleep (SWS) duration in controlled human studies, while morning administration raised GH without altering sleep architecture [7]. The nocturnal coupling is the rationale for pre-sleep dosing used across clinical protocols.
Bone density. Multi-year GH secretagogue trials in older adults documented improvements in bone mineral density alongside lean mass gains [14]. Effects were secondary to GH/IGF-1 axis restoration rather than a direct bone-active mechanism.
Sermorelin as a GHRH-Analog Peptide
Sermorelin is a synthetic peptide — specifically a GHRH-analog peptide — distinguished from ghrelin-receptor agonists (ipamorelin, GHRP-2, GHRP-6) by its molecular target. GHRH-receptor agonism increases the number of somatotrophs releasing GH per pulse. GHS-R1a agonism (the ghrelin pathway) increases GH release per individual somatotroph and suppresses somatostatin [18]. The two mechanisms are complementary and have been combined in compound pharmacy protocols to produce synergistic GH pulse amplitude [18].
Sermorelin vs CJC-1295: sermorelin is the unmodified GHRH(1-29) sequence with an approximately 11-12 minute plasma half-life. CJC-1295 incorporates amino acid substitutions that resist DPP-4 enzymatic degradation, extending active half-life to 30 minutes (without DAC) or 6-8 days (with DAC via albumin binding) [19]. The longer half-life of CJC-1295 with DAC produces a sustained GH/IGF-1 bleed rather than the physiological pulsatile pattern that sermorelin preserves.
Among GHRH-class peptides, sermorelin has the longest human safety and regulatory record, including the 1990 and 1997 FDA approvals and a 350-patient clinical trial adverse-event pool [2][15].
What Does Sermorelin Do to the Body?
Sermorelin stimulates pituitary somatotroph cells to synthesize and release GH in pulsatile bursts [1]. The sequence: GHRHR binding activates the Gs protein, adenylyl cyclase elevates cAMP, PKA phosphorylates secretory machinery, and voltage-gated calcium channels open, triggering GH secretory granule exocytosis [1].
Elevated GH then signals hepatic IGF-1 synthesis via the GH receptor. IGF-1 binds IGF-1R on peripheral tissues and mediates the downstream anabolic cascade — protein synthesis in skeletal muscle, lipolysis in adipose tissue (especially visceral fat depots), and bone remodeling [14].
Pulsatile GH amplitude — not tonic GH level or pulse frequency — is the primary determinant of fasting lipolysis. In a controlled study of 15 healthy subjects, GH pulse area under the curve correlated strongly with lipolysis rate (R=0.49, p=0.0015) [9]. Sermorelin's short half-life (~11-12 minutes) means the peptide clears before the GH pulse it triggers peaks; that 2-4 hour GH elevation preserves the pulsatile physiology that direct GH injections suppress [4][12].
As GH levels rise, somatostatin feedback from the hypothalamus is upregulated. This caps peak GH output and is the mechanism that prevents GH overstimulation with GHRH-analog dosing [2].
Sermorelin in Male Subjects: Clinical Observations
The most rigorous adult male efficacy data comes from a study of 14 hypogonadal men treated with GH secretagogues at 100 mcg three times daily. IGF-1 rose from a mean of 159.5 ng/mL to 239.0 ng/mL (delta: +79.5 ng/mL, p<0.0001) over a mean 134-day period [3]. Men concurrently taking estrogen-blocking agents showed smaller IGF-1 increases, indicating that estrogen facilitates GH axis responsiveness [3].
GH/IGF-1 axis decline correlates with age-related sarcopenia: advanced aging impairs signaling through the IGF-1 receptor due to reduced receptor density and affinity [14]. GH/IGF-1 elevation via secretagogues is necessary but not sufficient for functional muscle gain; the literature consistently shows that resistance exercise and caloric adequacy are required alongside the hormonal stimulus [14].
Effects on testosterone across sermorelin trials were secondary and inconsistent. Sermorelin acts on the GH axis, not the HPG (hypothalamic-pituitary-gonadal) axis directly.